Structure of PDB 2bop Chain A

Receptor sequence

>2bopA (length=85)

SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQ
ILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF

3D structure

• PDB: 2bop Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K339 R342 F343 T359 F361	K14 R17 F18 T34 F36

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006275 regulation of DNA replication
• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0042025 host cell nucleus

External links

• PDB: RCSB:2bop, PDBe:2bop, PDBj:2bop
• PDBsum: 2bop
• PubMed: 1328886
• UniProt: P03122|VE2_BPV1 Regulatory protein E2 (Gene Name=E2)