Structure of PDB 2bj7 Chain A |
>2bj7A (length=136) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] |
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVG NEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEV IVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE |
|
PDB | 2bj7 Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
A |
H89 H91 C97 |
H89 H91 C97 |
|
|
|
|