Structure of PDB 2bht Chain A

Receptor sequence

>2bhtA (length=294) Species: 562 (Escherichia coli)

MSTLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIV
EAEKRGRIKPGDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERR
AAMRAYGAELILVTKEQGMEGARDLALEMANRGEGKLLDQFNNPDNPKAH
YTTTGPEIWQQTGGRITHFVSSMGTTGTITGVSEFMREQSKPVTIVGLQP
EEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAENTMRELAVREGI
FCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVFGE

3D structure

• PDB: 2bht Structure of the O-Acetylserine Sulfhydrylase Isoenzyme Cysm from Escherichia Coli
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K41 S69 Q199 G203 S255 C280
• Catalytic site (residue number reindexed from 1): K41 S69 Q199 G203 S255 C280
• Enzyme Commision number: 2.5.1.47: cysteine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLP	A	K41 N71 M173 G174 T175 T176 T178 G208 S255 C280	K41 N71 M173 G174 T175 T176 T178 G208 S255 C280

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0016829 lyase activity
• GO:0030170 pyridoxal phosphate binding
• GO:0042803 protein homodimerization activity
• GO:0080146 L-cysteine desulfhydrase activity

Biological Process

• GO:0006535 cysteine biosynthetic process from serine
• GO:0016226 iron-sulfur cluster assembly
• GO:0019344 cysteine biosynthetic process
• GO:0019345 cysteine biosynthetic process via S-sulfo-L-cysteine
• GO:0019450 L-cysteine catabolic process to pyruvate

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2bht, PDBe:2bht, PDBj:2bht
• PDBsum: 2bht
• PubMed: 15952768
• UniProt: P16703|CYSM_ECOLI Cysteine synthase B (Gene Name=cysM)