Structure of PDB 2bhi Chain A

Receptor sequence
>2bhiA (length=60) Species: 8656 (Naja atra) [Search protein sequence]
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVK
YVCCNTDRCN
3D structure
PDB2bhi Glycosphingolipid-Facilitated Membrane Insertion and Internalization of Cobra Cardiotoxin: The Sulfatide/Cardiotoxin Complex Structure in a Membrane-Like Environment Suggests a Lipid-Dependent Cell-Penetrating Mechanism for Membrane Binding Polypeptides.
ChainA
Resolution2.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SFT A K12 P15 K18 Y22 K35 R36 G37 C38 K12 P15 K18 Y22 K35 R36 G37 C38
Gene Ontology
Biological Process
GO:0031640 killing of cells of another organism
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0044218 other organism cell membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bhi, PDBe:2bhi, PDBj:2bhi
PDBsum2bhi
PubMed16263708
UniProtP60301|3SA3_NAJAT Cytotoxin 3

[Back to BioLiP]