Structure of PDB 2bec Chain A

Receptor sequence

>2becA (length=181) Species: 9606 (Homo sapiens)

IPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTEKPEPLNSRRNK
LHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEAD
EDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

3D structure

• PDB: 2bec Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R30 R34 A56 L57 N60 P61 L62 I66 F83 L87 F90 Y118 L122 Y123 M143 R159 T160 E163 A164 F177 L181 K183 M184 K189 M190 S191 I192 R193 I194	R20 R24 A46 L47 N50 P51 L52 I56 F73 L77 F80 Y103 L107 Y108 M128 R144 T145 E148 A149 F162 L166 K168 M169 K174 M175 S176 I177 R178 I179

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0008284 positive regulation of cell population proliferation
• GO:0010922 positive regulation of phosphatase activity
• GO:0015031 protein transport
• GO:0042307 positive regulation of protein import into nucleus
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
• GO:0071277 cellular response to calcium ion

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:2bec, PDBe:2bec, PDBj:2bec
• PDBsum: 2bec
• PubMed: 16710297
• UniProt: O43745|CHP2_HUMAN Calcineurin B homologous protein 2 (Gene Name=CHP2)