Structure of PDB 2bdo Chain A

Receptor sequence

>2bdoA (length=80) Species: 469008 (Escherichia coli BL21(DE3))

EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQ
IEADKSGTVKAILVESGQPVEFDEPLVVIE

3D structure

• PDB: 2bdo Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 6.4.1.2: acetyl-CoA carboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BTN	A	Y92 P95 E119 K122	Y16 P19 E43 K46

Gene Ontology

Molecular Function

• GO:0003989 acetyl-CoA carboxylase activity

Biological Process

• GO:0006633 fatty acid biosynthetic process

Cellular Component

• GO:0009317 acetyl-CoA carboxylase complex

External links

• PDB: RCSB:2bdo, PDBe:2bdo, PDBj:2bdo
• PDBsum: 2bdo
• PubMed: 10213607
• UniProt: P0ABD8|BCCP_ECOLI Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Gene Name=accB)