Structure of PDB 2bcv Chain A

Receptor sequence

>2bcvA (length=323) Species: 9606 (Homo sapiens)

NLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSI
PGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMW
YQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKA
AQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLR
QEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACA
LLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLP
TPTEKDVFRLLGLPYREPAERDW

3D structure

• PDB: 2bcv Structural analysis of strand misalignment during DNA synthesis by a human DNA polymerase
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D427 D429 D490
• Catalytic site (residue number reindexed from 1): D175 D177 D238
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.
  4.2.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y267 W274 R275 G278 Y279 P303 G304 G306 R308 M309 K312	Y15 W22 R23 G26 Y27 P51 G52 G54 R56 M57 K60
BS02	dna	A	W342 G343 G345 K347 T348 D490 Y505	W90 G91 G93 K95 T96 D238 Y253
BS03	dna	A	W274 Q372 V462 S463 Q464 Q471 K472 R514 R517 K521 L527 E529 H530 H541 K544	W22 Q120 V210 S211 Q212 Q219 K220 R262 R265 K269 L275 E277 H278 H289 K292
BS04	MG	A	D427 D429	D175 D177
BS05	TTP	A	R386 S417 R420 G426 D427 D429 Y505 T507 G508 A510 N513	R134 S165 R168 G174 D175 D177 Y253 T255 G256 A258 N261

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:2bcv, PDBe:2bcv, PDBj:2bcv
• PDBsum: 2bcv
• PubMed: 16439207
• UniProt: Q9UGP5|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)