Structure of PDB 2bcu Chain A

Receptor sequence

>2bcuA (length=326) Species: 9606 (Homo sapiens)

TNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEA
CSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTA
QMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTV
QKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLD
SLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEF
ACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGR
VLPTPTEKDVFRLLGLPYREPAERDW

3D structure

• PDB: 2bcu Structural analysis of strand misalignment during DNA synthesis by a human DNA polymerase
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D427 D429 D490
• Catalytic site (residue number reindexed from 1): D178 D180 D241
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.
  4.2.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	W274 R275 G278 Y279 P303 G304 G306 R308 M309	W25 R26 G29 Y30 P54 G55 G57 R59 M60
BS02	dna	A	W342 G343 A344 G345 K347 T348 D427 D429 Y505 T507 G508 A510 N513 R517	W93 G94 A95 G96 K98 T99 D178 D180 Y256 T258 G259 A261 N264 R268
BS03	dna	A	W274 Q372 V462 S463 Q464 Q470 Q471 K472 R514 R517 K521 L527 S528 E529 H530 H541 K544 V545	W25 Q123 V213 S214 Q215 Q221 Q222 K223 R265 R268 K272 L278 S279 E280 H281 H292 K295 V296

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:2bcu, PDBe:2bcu, PDBj:2bcu
• PDBsum: 2bcu
• PubMed: 16439207
• UniProt: Q9UGP5|DPOLL_HUMAN DNA polymerase lambda (Gene Name=POLL)