Structure of PDB 2bc5 Chain A

Receptor sequence

>2bc5A (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 2bc5 Stability and Folding Kinetics of Structurally Characterized Cytochrome c-b(562).
• Chain: A
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	E4 M7 N11 P46 F61 F65 C98 C101 H102 R106	E4 M7 N11 P46 F61 F65 C98 C101 H102 R106

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2bc5, PDBe:2bc5, PDBj:2bc5
• PDBsum: 2bc5
• PubMed: 16939202
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)