Structure of PDB 2bam Chain A

Receptor sequence

>2bamA (length=207) Species: 1390 (Bacillus amyloliquefaciens)

MEVEKEFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNT
EKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFI
ENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAY
YLTDRVTNFEELEPYFELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSK
RSIKKWK

3D structure

• PDB: 2bam The role of metals in catalysis by the restriction endonuclease BamHI.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K146 Y150 R155 D196 G197 M198 S202 I203 W206	K146 Y150 R155 D196 G197 M198 S202 I203 W206
BS02	dna	A	V57 K61 K89 G90 G91 D94 E111 T114 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198	V57 K61 K89 G90 G91 D94 E111 T114 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198
BS03	CA	A	D94 E111 F112	D94 E111 F112
BS04	CA	A	E77 D94	E77 D94

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:2bam, PDBe:2bam, PDBj:2bam
• PDBsum: 2bam
• PubMed: 9783752
• UniProt: P23940|T2BA_BACAM Type II restriction enzyme BamHI (Gene Name=bamHIR)