Structure of PDB 2b8g Chain A |
>2b8gA (length=72) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEV KKKEGDFVNEGDVLLELSNSTQ |
|
PDB | 2b8g solution structure of Bacillus subtilis BLAP biotinylated-form (energy minimized mean structure) |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BTN |
A |
W12 K35 |
W11 K34 |
|
|
|