Structure of PDB 2b2d Chain A |
>2b2dA (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] |
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLSMKLTIPIFATNSD CELIVKAMQGLLKDGNPIPSAIAANSGIY |
|
PDB | 2b2d Structural basis of RNA binding discrimination between bacteriophages Qbeta and MS2 |
Chain | A |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
T45 S47 T59 Y85 |
T45 S47 T59 Y85 |
|
|
|
|