Structure of PDB 2b1o Chain A

Receptor sequence

>2b1oA (length=212) Species: 44689 (Dictyostelium discoideum) [Search protein sequence]

SVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVR
CNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVD
VKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIV
SHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDD
NTSFIFNLNSEK

3D structure

PDB

2b1o Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D39 F41 T81 N84	D38 F40 T80 N83
BS02	CA	A	D35 N38 E56	D34 N37 E55
BS03	CA	A	E59 D61 T179 Q181 N202	E58 D60 T178 Q180 N201

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005516	calmodulin binding
GO:0042802	identical protein binding

	Biological Process
GO:0007155	cell adhesion
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0010468	regulation of gene expression
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0030587	sorocarp development
GO:0031152	aggregation involved in sorocarp development
GO:0031288	sorocarp morphogenesis
GO:0050829	defense response to Gram-negative bacterium
GO:0051702	biological process involved in interaction with symbiont
GO:0098609	cell-cell adhesion
GO:1904643	response to curcumin

	Cellular Component
GO:0000331	contractile vacuole
GO:0001726	ruffle
GO:0005576	extracellular region
GO:0005737	cytoplasm
GO:0005811	lipid droplet
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0005938	cell cortex
GO:0009897	external side of plasma membrane
GO:0016020	membrane
GO:0030027	lamellipodium
GO:0030139	endocytic vesicle
GO:0030175	filopodium
GO:0031012	extracellular matrix
GO:0045335	phagocytic vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2b1o, PDBe:2b1o, PDBj:2b1o
PDBsum	2b1o
PubMed	17057715
UniProt	P54657\|CAD1_DICDI Calcium-dependent cell adhesion molecule 1 (Gene Name=cadA)

[Back to BioLiP]