Structure of PDB 2azh Chain A

Receptor sequence

>2azhA (length=147) Species: 1423 (Bacillus subtilis)

MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMK
LDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQ
GKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGN

3D structure

• PDB: 2azh Solution NMR Structure of Zn-Ligated Fe-S Cluster Assembly Scaffold Protein SufU From Bacillus subtilis
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 2.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C41 D43	C41 D43

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2azh, PDBe:2azh, PDBj:2azh
• PDBsum: 2azh
• UniProt: O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU (Gene Name=sufU)