Structure of PDB 2ayj Chain A |
>2ayjA (length=56) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] |
MPLTDPAKLQIVQQRVFLKKVCRKCGALNPIRATKCRRCHSTNLRLKKKE LPTKKG |
|
PDB | 2ayj Solution structure of ribosomal protein L40E, a unique C4 zinc finger protein encoded by archaeon Sulfolobus solfataricus |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C22 C25 C36 C39 |
C22 C25 C36 C39 |
|
|
|
|