Structure of PDB 2ayb Chain A

Receptor sequence
>2aybA (length=87) Species: 37122 (Human papillomavirus type 6a) [Search protein sequence]
SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHA
IVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL
3D structure
PDB2ayb The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S293 K297 R300 Y301 T316 H318 S13 K17 R20 Y21 T37 H39 PDBbind-CN: Kd=2nM
BS02 dna A N294 R302 P351 T353 N14 R22 P72 T74 PDBbind-CN: Kd=2nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ayb, PDBe:2ayb, PDBj:2ayb
PDBsum2ayb
PubMed16914454
UniProtQ84294|VE2_HPV6A Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]