Structure of PDB 2atx Chain A

Receptor sequence
>2atxA (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVS
VTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNV
KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQ
KLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
3D structure
PDB2atx An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
ChainA
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A T31 T49 D71 T24 T42 D64
BS02 GNP A G29 K30 T31 C32 T49 G74 Q130 D132 L133 A173 L174 G22 K23 T24 C25 T42 G67 Q123 D125 L126 A166 L167
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005522 profilin binding
GO:0005525 GTP binding
GO:0019901 protein kinase binding
GO:0032427 GBD domain binding
Biological Process
GO:0006897 endocytosis
GO:0007015 actin filament organization
GO:0007163 establishment or maintenance of cell polarity
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008286 insulin receptor signaling pathway
GO:0008360 regulation of cell shape
GO:0030866 cortical actin cytoskeleton organization
GO:0032869 cellular response to insulin stimulus
GO:0032956 regulation of actin cytoskeleton organization
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046039 GTP metabolic process
GO:0046326 positive regulation of D-glucose import
GO:0051491 positive regulation of filopodium assembly
GO:1903077 negative regulation of protein localization to plasma membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0030660 Golgi-associated vesicle membrane
GO:0045121 membrane raft
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2atx, PDBe:2atx, PDBj:2atx
PDBsum2atx
PubMed16246732
UniProtP17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ (Gene Name=RHOQ)

[Back to BioLiP]