Structure of PDB 2atp Chain A |
>2atpA (length=118) Species: 10090 (Mus musculus) [Search protein sequence] |
APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFV VYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCS VISNSVMYFSSVVPVLQK |
|
PDB | 2atp Structural and Mutational Analyses of a CD8alphabeta Heterodimer and Comparison with the CD8alphaalpha Homodimer. |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
S45 K46 |
S42 K43 |
|
|
|