Structure of PDB 2asl Chain A

Receptor sequence

>2aslA (length=341) Species: 2287 (Saccharolobus solfataricus)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2asl Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion
• Chain: A
• Resolution: 2.65 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	A44 A57 G185 G187 I189 T190 R298 R300 T301 K339	A44 A57 G185 G187 I189 T190 R298 R300 T301 K339
BS02	dna	A	V32 S34 G41 A42 P60 E63 K66 G218 A220 R242 K243 S244 G246 R247 I248 T250 L293 R336	V32 S34 G41 A42 P60 E63 K66 G218 A220 R242 K243 S244 G246 R247 I248 T250 L293 R336
BS03	CA	A	D7 D105 E106	D7 D105 E106

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2asl, PDBe:2asl, PDBj:2asl
• PDBsum: 2asl
• PubMed: 16379496
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)