Structure of PDB 2asj Chain A

Receptor sequence

>2asjA (length=341) Species: 2287 (Saccharolobus solfataricus)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2asj Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	A44 D105 E106 G185 G187 I189 T190 V296 S297 R298 T301	A44 D105 E106 G185 G187 I189 T190 V296 S297 R298 T301
BS02	dna	A	V32 G41 A42 A220 R242 K243 S244 I245 G246 R247 I248 T250 R336	V32 G41 A42 A220 R242 K243 S244 I245 G246 R247 I248 T250 R336
BS03	CA	A	D7 D105 E106	D7 D105 E106

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2asj, PDBe:2asj, PDBj:2asj
• PDBsum: 2asj
• PubMed: 16379496
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)