Structure of PDB 2aro Chain A |
>2aroA (length=106) Species: 9031 (Gallus gallus) [Search protein sequence] |
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQ AVLLPK |
|
PDB | 2aro The oxidised histone octamer does not form a H3 disulphide bond. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
A |
R29 R32 K36 |
R17 R20 K24 |
|
|
|
|