Structure of PDB 2aoq Chain A

Receptor sequence

>2aoqA (length=220) Species: 727 (Haemophilus influenzae) [Search protein sequence]

MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERA
LGATAGSKAEQDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKW
ENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDW
EELMDLIVLGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLP
LGFYLRKEFTAQILNAFLET

3D structure

PDB

2aoq MutH complexed with hemi- and unmethylated DNAs: coupling base recognition and DNA cleavage.

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R46 K48 T174 A175 R176 R184 G187 A188 N189 S190 R214 K215	R38 K40 T166 A167 R168 R176 G179 A180 N181 S182 R206 K207	PDBbind-CN: Kd=3.5uM
BS02	dna	A	K48 G49 G52 E56 G64 S65 E68 D70 T80 P82 E91 F94 L97 K116 R129 K186 T194	K40 G41 G44 E48 G56 S57 E60 D62 T72 P74 E83 F86 L89 K108 R121 K178 T186	PDBbind-CN: Kd=3.5uM
BS03	CA	A	E56 T62 D70	E48 T54 D62
BS04	CA	A	D70 E77 L78	D62 E69 L70

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair
GO:0006298	mismatch repair
GO:0006304	DNA modification

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2aoq, PDBe:2aoq, PDBj:2aoq
PDBsum	2aoq
PubMed	16209953
UniProt	P44688\|MUTH_HAEIN DNA mismatch repair protein MutH (Gene Name=mutH)

[Back to BioLiP]