Structure of PDB 2anv Chain A |
>2anvA (length=146) Species: 10754 (Lederbergvirus P22) [Search protein sequence] |
MMQISSNGITRLKREEGERLKAYSDSRGIPTIGVGHTGKVDGNSVASGMT ITAEKSSELLKEDLQWVEDAISSLVRVPLNQNQYDAMCSLIFNIGKSAFA GSTVLRQLNLKNYQAAADAFLLWKKAGKDPDILLPRRRRERALFLS |
|
PDB | 2anv Extension to 2268 atoms of direct methods in the ab initio determination of the unknown structure of bacteriophage P22 lysozyme. |
Chain | A |
Resolution | 1.04 Å |
3D structure |
|
|
Enzyme Commision number |
3.2.1.17: lysozyme. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SM |
A |
E62 Q65 |
E62 Q65 |
|
BS02 |
SM |
A |
E54 E58 |
E54 E58 |
|
|
|
|