Structure of PDB 2ans Chain A

Receptor sequence

>2ansA (length=131) Species: 10090 (Mus musculus)

CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVT
IRSESTFKNTEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQKWDGK
STTIKRKRDGDKLVVECVMKGVTSTRVYERA

3D structure

• PDB: 2ans Studies of the ligand binding reaction of adipocyte lipid binding protein using the fluorescent probe 1, 8-anilinonaphthalene-8-sulfonate.
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2AN	A	F16 F57 R78 V115 C117 R126 Y128	F16 F57 R78 V115 C117 R126 Y128	MOAD: Kd=1.2uM PDBbind-CN: -logKd/Ki=5.92,Kd=1.2uM

Gene Ontology

Molecular Function

• GO:0005324 long-chain fatty acid transmembrane transporter activity
• GO:0008289 lipid binding
• GO:0036041 long-chain fatty acid binding
• GO:0051427 hormone receptor binding

Biological Process

• GO:0009617 response to bacterium
• GO:0015909 long-chain fatty acid transport
• GO:0042632 cholesterol homeostasis
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0050729 positive regulation of inflammatory response
• GO:0050872 white fat cell differentiation
• GO:0050873 brown fat cell differentiation
• GO:0071285 cellular response to lithium ion
• GO:0071356 cellular response to tumor necrosis factor
• GO:0120162 positive regulation of cold-induced thermogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ans, PDBe:2ans, PDBj:2ans
• PDBsum: 2ans
• PubMed: 10423455
• UniProt: P04117|FABP4_MOUSE Fatty acid-binding protein, adipocyte (Gene Name=Fabp4)