Structure of PDB 2ams Chain A

Receptor sequence
>2amsA (length=83) Species: 1049 (Allochromatium vinosum) [Search protein sequence]
AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQ
ANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG
3D structure
PDB2ams Geometric factors determine, in part, the electronic state of the 4Fe-4S cluster of Hipip from thermochromtium tepidum: a geomteric, crystallographic, and theoretical study.
ChainA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A Y19 C43 C46 F48 M49 C61 C75 W78 Y19 C43 C46 F48 M49 C61 C75 W78
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0019646 aerobic electron transport chain

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ams, PDBe:2ams, PDBj:2ams
PDBsum2ams
PubMed
UniProtP80176|HIP_THETI High-potential iron-sulfur protein (Gene Name=hip)

[Back to BioLiP]