Structure of PDB 2ale Chain A

Receptor sequence

>2aleA (length=132) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISE
FIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAA
SITTNDASAIKTQIYAVKDKIETLLILEHHHH

3D structure

PDB

2ale Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.

Chain

Resolution

1.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D73 H132	D73 H132

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0000452	snoRNA guided rRNA 2'-O-methylation
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494	box C/D sno(s)RNA 3'-end processing
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005687	U4 snRNP
GO:0005730	nucleolus
GO:0031428	box C/D methylation guide snoRNP complex
GO:0032040	small-subunit processome
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071011	precatalytic spliceosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2ale, PDBe:2ale, PDBj:2ale
PDBsum	2ale
PubMed	17631273
UniProt	P39990\|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)