Structure of PDB 2al7 Chain A

Receptor sequence

>2al7A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence]

SKEEMELTLVGLQYSGKTTFVNVIAVGFNMRKVTKGNVTIKIWDIGGQPR
FRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLV
LGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL
IQHSK

3D structure

PDB

2al7 GTP-like conformation of GDP-bound ARL10C GTPase

Chain

Resolution

1.85 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Q74
Catalytic site (residue number reindexed from 1)	Q48
Enzyme Commision number	3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	Y29 S30 G31 K32 T33 T34 N129 K130 D132 L133 S162 K164	Y14 S15 G16 K17 T18 T19 N103 K104 D106 L107 S136 K138

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0043014	alpha-tubulin binding
GO:0048487	beta-tubulin binding

	Biological Process
GO:0001778	plasma membrane repair
GO:0002505	antigen processing and presentation of polysaccharide antigen via MHC class II
GO:0002747	antigen processing and presentation following phagocytosis
GO:0007059	chromosome segregation
GO:0008089	anterograde axonal transport
GO:0015031	protein transport
GO:0016197	endosomal transport
GO:0032418	lysosome localization
GO:0034498	early endosome to Golgi transport
GO:0042267	natural killer cell mediated cytotoxicity
GO:0046754	viral exocytosis
GO:0051301	cell division
GO:0061909	autophagosome-lysosome fusion
GO:0090117	endosome to lysosome transport of low-density lipoprotein particle
GO:0090385	phagosome-lysosome fusion
GO:1902774	late endosome to lysosome transport
GO:1902946	protein localization to early endosome
GO:1990927	calcium ion regulated lysosome exocytosis

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005819	spindle
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016020	membrane
GO:0030424	axon
GO:0030496	midbody
GO:0031901	early endosome membrane
GO:0031902	late endosome membrane
GO:0042995	cell projection
GO:0045202	synapse
GO:0051233	spindle midzone
GO:0070062	extracellular exosome
GO:0101004	cytolytic granule membrane
GO:1904115	axon cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2al7, PDBe:2al7, PDBj:2al7
PDBsum	2al7
PubMed
UniProt	Q9NVJ2\|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B (Gene Name=ARL8B)

[Back to BioLiP]