Structure of PDB 2ak3 Chain A

Receptor sequence
>2ak3A (length=226) Species: 9913 (Bos taurus) [Search protein sequence]
GASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTE
IGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEA
LDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGID
DLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTET
NKIWPHVYAFLQTKLPQRSQETSVTP
3D structure
PDB2ak3 The refined structure of the complex between adenylate kinase from beef heart mitochondrial matrix and its substrate AMP at 1.85 A resolution.
ChainA
Resolution1.85 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K18 R92 R126 R159 R170
Catalytic site (residue number reindexed from 1) K19 R93 R127 R160 R171
Enzyme Commision number 2.7.4.10: nucleoside-triphosphate--adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A G15 G17 K18 G19 G16 G18 K19 G20
BS02 AMP A S36 L40 I58 K62 L63 I64 M69 R92 Q96 S37 L41 I59 K63 L64 I65 M70 R93 Q97
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0046899 nucleoside triphosphate adenylate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006172 ADP biosynthetic process
GO:0009142 nucleoside triphosphate biosynthetic process
GO:0016310 phosphorylation
GO:0046033 AMP metabolic process
GO:0046039 GTP metabolic process
GO:0046041 ITP metabolic process
GO:0046051 UTP metabolic process
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ak3, PDBe:2ak3, PDBj:2ak3
PDBsum2ak3
PubMed1994037
UniProtP08760|KAD3_BOVIN GTP:AMP phosphotransferase AK3, mitochondrial (Gene Name=AK3)

[Back to BioLiP]