Structure of PDB 2aiu Chain A

Receptor sequence
>2aiuA (length=104) Species: 10090 (Mus musculus) [Search protein sequence]
GDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTD
ANKNKGVIWSEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQ
ATSS
3D structure
PDB2aiu Remarkably high activities of testicular cytochrome c in destroying reactive oxygen species and in triggering apoptosis
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A C15 Q17 C18 H19 P31 L36 G42 Y49 T50 N53 W60 Y68 L69 T79 K80 M81 F83 C14 Q16 C17 H18 P30 L35 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006915 apoptotic process
GO:0042743 hydrogen peroxide metabolic process
GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2aiu, PDBe:2aiu, PDBj:2aiu
PDBsum2aiu
PubMed16757556
UniProtP00015|CYC2_MOUSE Cytochrome c, testis-specific (Gene Name=Cyct)

[Back to BioLiP]