Structure of PDB 2ago Chain A

Receptor sequence

>2agoA (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2ago Fidelity of Dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis.
• Chain: A
• Resolution: 2.85 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G185 G187 I189 T190 S297 R298 R300 T301 K339	G185 G187 I189 T190 S297 R298 R300 T301 K339
BS02	dna	A	V32 S34 F37 S40 G41 G218 A220 K221 K243 S244 G246 R247 I248 L293 R336	V32 S34 F37 S40 G41 G218 A220 K221 K243 S244 G246 R247 I248 L293 R336
BS03	MG	A	D105 E106	D105 E106
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	MG	A	A181 I186	A181 I186
BS06	POP	A	D7 Y10 R51 D105	D7 Y10 R51 D105

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ago, PDBe:2ago, PDBj:2ago
• PDBsum: 2ago
• PubMed: 16107880
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)