Structure of PDB 2ab4 Chain A

Receptor sequence

>2ab4A (length=300) Species: 2336 (Thermotoga maritima)

MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGV
NQGTRILEFYKDLKKVFWVKMRLGLITETFDITGEVVEERECNVTEEEIR
EAIFSFVGEYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIW
DVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGPHT
IEESLNVFEAAPEEIENRIIPLEKCLEWLPRVVVHQESTKMILNGSQIHL
EMLKEWDGFKKGEVVRVFNEEGRLLALAEAERNSSFRQERVLTLRKVFQT

3D structure

• PDB: 2ab4 Dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 5.4.99.25: tRNA pseudouridine(55) synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	T15 H17 K31 V32 G33 H34 G36 T37 L38 D39 P40 T54 K61 F67 T79 D81 Y117 S118 A119 K120 K121 G124 R126 Y128 R132 Y170 I171 R172 L191	T15 H17 K31 V32 G33 H34 G36 T37 L38 D39 P40 T54 K61 F67 T79 D81 Y117 S118 A119 K120 K121 G124 R126 Y128 R132 Y170 I171 R172 L191

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0140098 catalytic activity, acting on RNA
• GO:0160148 tRNA pseudouridine(55) synthase activity

Biological Process

• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031119 tRNA pseudouridine synthesis
• GO:1990481 mRNA pseudouridine synthesis

External links

• PDB: RCSB:2ab4, PDBe:2ab4, PDBj:2ab4
• PDBsum: 2ab4
• PubMed: 16300397
• UniProt: Q9WZW0|TRUB_THEMA tRNA pseudouridine synthase B (Gene Name=truB)