Structure of PDB 2a66 Chain A

Receptor sequence
>2a66A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKT
QRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL
3D structure
PDB2a66 Crystal Structure of the Human LRH-1 DBD-DNA Complex Reveals Ftz-F1 Domain Positioning is Required for Receptor Activity.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y96 H97 Y98 K107 K111 V156 R157 M161 R162 R165 N166 Y172 Y13 H14 Y15 K24 K28 V73 R74 M78 R79 R82 N83 Y89 PDBbind-CN: Kd=122nM
BS02 dna A E104 S105 R112 R135 K136 R142 R162 G163 G164 E21 S22 R29 R52 K53 R59 R79 G80 G81 PDBbind-CN: Kd=122nM
BS03 ZN A C86 C89 C103 C106 C3 C6 C20 C23
BS04 ZN A C122 C128 C141 C39 C45 C58
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2a66, PDBe:2a66, PDBj:2a66
PDBsum2a66
PubMed16289203
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]