Structure of PDB 2a4g Chain A

Receptor sequence

>2a4gA (length=181) [Search protein sequence]

APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCING
VCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHA
VGLFRAAVCTRGVAKAVDFIPVENLETTMRS

3D structure

PDB

2a4g Hepatitis C virus NS3-4a serine protease inhibitors. SAR of P2' moiety with improved potency.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D81 G137 S139
Catalytic site (residue number reindexed from 1)	H57 D81 G137 S139
Enzyme Commision number	2.7.7.48: RNA-directed RNA polymerase. 3.4.21.98: hepacivirin. 3.4.22.- 3.6.1.15: nucleoside-triphosphate phosphatase. 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T4 A5 Y6 A7 Q8 Q9 T10 R11 C16 T19 S20 E30 E32 V33 Q34 I35 V36 S37 R62 T63 I64 A65 V107 R109	T4 A5 Y6 A7 Q8 Q9 T10 R11 C16 T19 S20 E30 E32 V33 Q34 I35 V36 S37 R62 T63 I64 A65 V107 R109
BS02	peptide	A	T4 A5 Y6 A7 Q8	T4 A5 Y6 A7 Q8
BS03	ZN	A	C99 C145	C99 C145
BS04	UNH	A	Q41 T42 H57 R123 K136 G137 S139 R155 A156 A157 D168	Q41 T42 H57 R123 K136 G137 S139 R155 A156 A157 D168	PDBbind-CN: -logKd/Ki=7.18,Ki=0.066uM

Gene Ontology

	Molecular Function
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0019087	transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2a4g, PDBe:2a4g, PDBj:2a4g
PDBsum	2a4g
PubMed	16087332
UniProt	P26664\|POLG_HCV1 Genome polyprotein

[Back to BioLiP]