Structure of PDB 2a3r Chain A

Receptor sequence
>2a3rA (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]
RPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQIL
DMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSH
LPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSF
LEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKIL
EFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRK
GMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
3D structure
PDB2a3r Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K48 H108 S138
Catalytic site (residue number reindexed from 1) K40 H100 S130
Enzyme Commision number 2.8.2.1: aryl sulfotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A3P A K48 G50 T51 T52 W53 R130 S138 Y193 T227 S228 F229 F255 M256 R257 K258 G259 K40 G42 T43 T44 W45 R122 S130 Y185 T219 S220 F221 F247 M248 R249 K250 G251
BS02 LDP A F24 P47 F81 D86 K106 H108 F142 E146 H149 F16 P39 F73 D78 K98 H100 F134 E138 H141
Gene Ontology
Molecular Function
GO:0004062 aryl sulfotransferase activity
GO:0005515 protein binding
GO:0008146 sulfotransferase activity
GO:0016740 transferase activity
GO:0043199 sulfate binding
GO:0047685 amine sulfotransferase activity
Biological Process
GO:0006068 ethanol catabolic process
GO:0006584 catecholamine metabolic process
GO:0006805 xenobiotic metabolic process
GO:0008202 steroid metabolic process
GO:0009812 flavonoid metabolic process
GO:0042417 dopamine metabolic process
GO:0042420 dopamine catabolic process
GO:0050427 3'-phosphoadenosine 5'-phosphosulfate metabolic process
GO:0051923 sulfation
GO:1903351 cellular response to dopamine
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2a3r, PDBe:2a3r, PDBj:2a3r
PDBsum2a3r
PubMed16083857
UniProtP0DMM9|ST1A3_HUMAN Sulfotransferase 1A3 (Gene Name=SULT1A3)

[Back to BioLiP]