Structure of PDB 2a1t Chain A

Receptor sequence
>2a1tA (length=386) Species: 9606 (Homo sapiens) [Search protein sequence]
LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWEL
GLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPII
IAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYI
INGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIG
RKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVV
AAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELAR
MSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTE
YPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK
3D structure
PDB2a1t Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
ChainA
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V135 T136 T255 E376 R388
Catalytic site (residue number reindexed from 1) V126 T127 T246 E367 R379
Enzyme Commision number 1.3.8.7: medium-chain acyl-CoA dehydrogenase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 FAD A Y133 V135 T136 G141 S142 W166 I167 T168 I371 Y375 T378 Q380 Y124 V126 T127 G132 S133 W157 I158 T159 I362 Y366 T369 Q371
BS02 FAD A R281 T283 F284 L288 H291 I294 Q349 I350 G353 R272 T274 F275 L279 H282 I285 Q340 I341 G344
Gene Ontology
Molecular Function
GO:0003995 acyl-CoA dehydrogenase activity
GO:0016491 oxidoreductase activity
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
GO:0042802 identical protein binding
GO:0050660 flavin adenine dinucleotide binding
GO:0070991 medium-chain fatty acyl-CoA dehydrogenase activity
Biological Process
GO:0001889 liver development
GO:0005978 glycogen biosynthetic process
GO:0006082 organic acid metabolic process
GO:0006111 regulation of gluconeogenesis
GO:0006631 fatty acid metabolic process
GO:0006635 fatty acid beta-oxidation
GO:0007507 heart development
GO:0009409 response to cold
GO:0009437 carnitine metabolic process
GO:0009791 post-embryonic development
GO:0019254 carnitine metabolic process, CoA-linked
GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042594 response to starvation
GO:0045329 carnitine biosynthetic process
GO:0051791 medium-chain fatty acid metabolic process
GO:0051793 medium-chain fatty acid catabolic process
GO:0055007 cardiac muscle cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0030424 axon
GO:0031966 mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2a1t, PDBe:2a1t, PDBj:2a1t
PDBsum2a1t
PubMed15975918
UniProtP11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Gene Name=ACADM)

[Back to BioLiP]