Structure of PDB 208l Chain A

Receptor sequence
>208lA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence]
KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR
STDYGIFQINSRYWCNDGKTPGAVNAAHLSCSALLQDNIADAVACAKRVV
RDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
3D structure
PDB208l A role of PDI in the reductive cleavage of mixed disulfides.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E35 N46 D49 S51 D53 N60
Catalytic site (residue number reindexed from 1) E35 N46 D49 S51 D53 N60
Enzyme Commision number 3.2.1.17: lysozyme.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CYS A W64 H78 L79 C95 W64 H78 L79 C95
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0042802 identical protein binding
Biological Process
GO:0006954 inflammatory response
GO:0019730 antimicrobial humoral response
GO:0031640 killing of cells of another organism
GO:0042742 defense response to bacterium
GO:0050829 defense response to Gram-negative bacterium
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0035578 azurophil granule lumen
GO:0035580 specific granule lumen
GO:0070062 extracellular exosome
GO:1904724 tertiary granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:208l, PDBe:208l, PDBj:208l
PDBsum208l
PubMed8902616
UniProtP61626|LYSC_HUMAN Lysozyme C (Gene Name=LYZ)

[Back to BioLiP]