Structure of PDB 1zsn Chain A

Receptor sequence

>1zsnA (length=292) Species: 5833 (Plasmodium falciparum)

EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGK
FDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIE
DVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLI
SLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLA
YHLGRNYNIRINTISAGPLKSRAATAINYTFIDYAIEYSEKYAPLRQKLL
STDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDDIYRN

3D structure

• PDB: 1zsn Synthesis, biological activity, and X-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acyl carrier protein reductase. Part 1: 4'-Substituted triclosan derivatives.
• Chain: A
• Resolution: 2.992 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y277 K285
• Catalytic site (residue number reindexed from 1): Y181 K189
• Enzyme Commision number: 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	I105 G110 Y111 W131 D168 A169 S215 L216 N218 L265 T266 Y267 K285 A312 G313 P314 L315 S317 A319	I9 G14 Y15 W35 D72 A73 S119 L120 N122 L169 T170 Y171 K189 A216 G217 P218 L219 S221 A223
BS02	TN2	A	A217 N218 A219 V222 Y267 Y277 A319 A320	A121 N122 A123 V126 Y171 Y181 A223 A224

Gene Ontology

Molecular Function

• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:1zsn, PDBe:1zsn, PDBj:1zsn
• PDBsum: 1zsn
• PubMed: 16198563
• UniProt: Q9BH77