Structure of PDB 1zs0 Chain A

Receptor sequence
>1zs0A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence]
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFT
RISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAE
ETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSL
PQDDIDGIQAIYG
3D structure
PDB1zs0 Structural insight into the stereoselective inhibition of MMP-8 by enantiomeric sulfonamide phosphonates.
ChainA
Resolution1.56 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H197 E198 H201 H207
Catalytic site (residue number reindexed from 1) H118 E119 H122 H128
Enzyme Commision number 3.4.24.34: neutrophil collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D137 G169 I170 G171 D173 D58 G90 I91 G92 D94
BS02 CA A D154 G155 N157 I159 D177 E180 D75 G76 N78 I80 D98 E101
BS03 ZN A H147 D149 H162 H175 H68 D70 H83 H96
BS04 ZN A H197 H201 H207 H118 H122 H128
BS05 EIN A I159 L160 A161 L193 V194 H197 E198 H201 H207 L214 Y216 P217 N218 Y219 I80 L81 A82 L114 V115 H118 E119 H122 H128 L135 Y137 P138 N139 Y140 MOAD: Ki=0.7uM
PDBbind-CN: -logKd/Ki=6.15,Ki=700nM
BindingDB: Ki=700nM,IC50=810nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zs0, PDBe:1zs0, PDBj:1zs0
PDBsum1zs0
PubMed16451058
UniProtP22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)

[Back to BioLiP]