Structure of PDB 1zfs Chain A

Receptor sequence
>1zfsA (length=93) Species: 10116 (Rattus norvegicus) [Search protein sequence]
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKD
ADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
3D structure
PDB1zfs The three-dimensional solution structure of Ca(2+)-bound S100A1 as determined by NMR spectroscopy
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A L61 D62 D66 E68 E73 L61 D62 D66 E68 E73
BS02 CA A S19 D24 K27 L28 E32 S19 D24 K27 L28 E32
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051117 ATPase binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0008016 regulation of heart contraction
GO:1903672 positive regulation of sprouting angiogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0016529 sarcoplasmic reticulum
GO:0030018 Z disc
GO:0031430 M band
GO:0031672 A band
GO:0031674 I band

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zfs, PDBe:1zfs, PDBj:1zfs
PDBsum1zfs
PubMed16169012
UniProtP35467|S10A1_RAT Protein S100-A1 (Gene Name=S100a1)

[Back to BioLiP]