Structure of PDB 1zfo Chain A

Receptor sequence
>1zfoA (length=30) Species: 9823 (Sus scrofa) [Search protein sequence]
MNPNCARCGKIVYPTEKVNCLDKFWHKACF
3D structure
PDB1zfo Solution structure of a naturally-occurring zinc-peptide complex demonstrates that the N-terminal zinc-binding module of the Lasp-1 LIM domain is an independent folding unit.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C5 C8 H26 C29 C5 C8 H26 C29
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0015075 monoatomic ion transmembrane transporter activity
GO:0046872 metal ion binding
Biological Process
GO:0006811 monoatomic ion transport
GO:0034220 monoatomic ion transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005938 cell cortex
GO:0030864 cortical actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zfo, PDBe:1zfo, PDBj:1zfo
PDBsum1zfo
PubMed8841116
UniProtP80171|LASP1_PIG LIM and SH3 domain protein 1 (Fragment) (Gene Name=LASP1)

[Back to BioLiP]