Structure of PDB 1zd9 Chain A

Receptor sequence
>1zd9A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]
SKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVT
IKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLD
KPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKE
KDNIDITLQWLIQHSK
3D structure
PDB1zd9 Structure of human ADP-ribosylation factor-like 10B
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q74 R83
Catalytic site (residue number reindexed from 1) Q59 R68
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A Y29 S30 G31 K32 T33 T34 F44 E46 M48 N129 K130 D132 L133 S162 C163 K164 Y14 S15 G16 K17 T18 T19 F29 E31 M33 N114 K115 D117 L118 S147 C148 K149
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0043014 alpha-tubulin binding
GO:0048487 beta-tubulin binding
Biological Process
GO:0007059 chromosome segregation
GO:0008089 anterograde axonal transport
GO:0015031 protein transport
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030424 axon
GO:0030496 midbody
GO:0031902 late endosome membrane
GO:0035577 azurophil granule membrane
GO:0042995 cell projection
GO:0045202 synapse
GO:0051233 spindle midzone
GO:0070062 extracellular exosome
GO:0101003 ficolin-1-rich granule membrane
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zd9, PDBe:1zd9, PDBj:1zd9
PDBsum1zd9
PubMed
UniProtQ96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A (Gene Name=ARL8A)

[Back to BioLiP]