Structure of PDB 1zbu Chain A

Receptor sequence
>1zbuA (length=225) Species: 9606 (Homo sapiens) [Search protein sequence]
SYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYV
RPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDLMKLKELGTKYK
YSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQ
TKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHA
GQLMSVSSSLPIEGTPPPQMPHFRK
3D structure
PDB1zbu Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
ChainA
Resolution2.998 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D134 E136 D234 H293 D298
Catalytic site (residue number reindexed from 1) D10 E12 D110 H169 D174
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D134 D234 D10 D110
BS02 MG A D134 E136 D298 D10 E12 D174
BS03 AMP A E136 A137 C139 N143 F185 H293 E12 A13 C15 N19 F61 H169
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008408 3'-5' exonuclease activity
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0046872 metal ion binding
GO:0071207 histone pre-mRNA stem-loop binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031125 rRNA 3'-end processing
GO:0071044 histone mRNA catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0071204 histone pre-mRNA 3'end processing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zbu, PDBe:1zbu, PDBj:1zbu
PDBsum1zbu
PubMed
UniProtQ8IV48|ERI1_HUMAN 3'-5' exoribonuclease 1 (Gene Name=ERI1)

[Back to BioLiP]