Structure of PDB 1zbk Chain A

Receptor sequence
>1zbkA (length=361) Species: 9940 (Ovis aries) [Search protein sequence]
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEW
NDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIK
SVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQ
LLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSP
LFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKT
DVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKG
NQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPL
TSAVKDVLAEV
3D structure
PDB1zbk Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D115 A117 L119 Y185
Catalytic site (residue number reindexed from 1) D115 A117 L119 Y185
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W191 P260 E269 K270 W191 P259 E268 K269
Gene Ontology
Molecular Function
GO:0008061 chitin binding
GO:0030246 carbohydrate binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006032 chitin catabolic process
GO:0006915 apoptotic process
GO:0006954 inflammatory response
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0009612 response to mechanical stimulus
GO:0010800 positive regulation of peptidyl-threonine phosphorylation
GO:0030324 lung development
GO:0032757 positive regulation of interleukin-8 production
GO:0034612 response to tumor necrosis factor
GO:0045766 positive regulation of angiogenesis
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070555 response to interleukin-1
GO:0070741 response to interleukin-6
GO:0071356 cellular response to tumor necrosis factor
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zbk, PDBe:1zbk, PDBj:1zbk
PDBsum1zbk
PubMed
UniProtQ6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 (Gene Name=CHI3L1)

[Back to BioLiP]