Structure of PDB 1z9k Chain A

Receptor sequence

>1z9kA (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 1z9k Design of a Redox-Linked Active Metal Site: Manganese Bound to Bacterial Reaction Centers at a Site Resembling That of Photosystem II
• Chain: A
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	A	M174 I177 S178 F181 T182	M174 I177 S178 F181 T182
BS02	BCL	A	F97 A127 L131 V157 Y162 F167 H168 H173 F180 S244 A245 M248	F97 A127 L131 V157 Y162 F167 H168 H173 F180 S244 A245 M248
BS03	BPH	A	A42 I46 W100 E104 A120 F121 Y148 G149 H153 L238	A42 I46 W100 E104 A120 F121 Y148 G149 H153 L238
BS04	U10	A	F216 Y222 S223 I224 I229	F216 Y222 S223 I224 I229
BS05	FE	A	H190 H230	H190 H230
BS06	BCL	A	Y128 F146 H153 L154	Y128 F146 H153 L154
BS07	BPH	A	F181 A184 L185 L189	F181 A184 L185 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1z9k, PDBe:1z9k, PDBj:1z9k
• PDBsum: 1z9k
• PubMed: 15895982
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)