Structure of PDB 1z83 Chain A

Receptor sequence
>1z83A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence]
SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSS
GSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREV
QQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKR
LETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
3D structure
PDB1z83 Crystal structure of human AK1A in complex with AP5A
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K21 R97 R132 R138 R149
Catalytic site (residue number reindexed from 1) K22 R98 R133 R139 R150
Enzyme Commision number 2.7.4.10: nucleoside-triphosphate--adenylate kinase.
2.7.4.3: adenylate kinase.
2.7.4.6: nucleoside-diphosphate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A E26 H36 E27 H37
BS02 AP5 A P17 G18 S19 G20 K21 G22 T23 T39 G40 L43 M61 Q65 L66 V67 G94 R97 Q101 R128 R132 R138 R149 V179 P18 G19 S20 G21 K22 G23 T24 T40 G41 L44 M62 Q66 L67 V68 G95 R98 Q102 R129 R133 R139 R150 V180
BS03 ZN A E70 D74 E71 D75
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019205 nucleobase-containing compound kinase activity
GO:0047506 (deoxy)adenylate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006172 ADP biosynthetic process
GO:0009142 nucleoside triphosphate biosynthetic process
GO:0015949 nucleobase-containing small molecule interconversion
GO:0016310 phosphorylation
GO:0046033 AMP metabolic process
GO:0046034 ATP metabolic process
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0001520 outer dense fiber
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0036126 sperm flagellum
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1z83, PDBe:1z83, PDBj:1z83
PDBsum1z83
PubMed
UniProtP00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 (Gene Name=AK1)

[Back to BioLiP]