Structure of PDB 1yxh Chain A |
>1yxhA (length=119) Species: 195058 (Naja sagittifera) [Search protein sequence] |
NIYQFKNMIQCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDNC YNQAQEITGCRPKWKTYTYECSQGTLTCKGRNNACAATVCDCDRLAAICF AGAPYNDNNYNIDLKARCQ |
|
PDB | 1yxh Crystal structure of a novel phospholipase A(2) from Naja naja sagittifera with a strong anticoagulant activity |
Chain | A |
Resolution | 1.86 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
Y28 G30 G32 D49 |
Y27 G29 G31 D48 |
|
|
|
|