Structure of PDB 1ywh Chain A

Receptor sequence
>1ywhA (length=268) Species: 9606 (Homo sapiens) [Search protein sequence]
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK
TNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRSRYLECISCGSSDMSCE
RGRHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHN
NDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETF
LIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHI
DVSCCTKSGCNHPDLDVQ
3D structure
PDB1ywh Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E42 R53 T54 Y57 L66 S100 S101 V125 R142 L168 H251 D254 A255 N259 E42 R53 T54 Y57 L66 S94 S95 V119 R131 L157 H240 D243 A244 N248
BS02 peptide A R2 M4 V14 D74 L75 R2 M4 V14 D74 L75
BS03 FUC A G82 S117 G82 S111
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0030377 urokinase plasminogen activator receptor activity
GO:0038023 signaling receptor activity
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007596 blood coagulation
GO:0010755 regulation of plasminogen activation
GO:0030155 regulation of cell adhesion
GO:0030162 regulation of proteolysis
GO:0034112 positive regulation of homotypic cell-cell adhesion
GO:0038195 urokinase plasminogen activator signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0043388 positive regulation of DNA binding
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0051917 regulation of fibrinolysis
GO:0090200 positive regulation of release of cytochrome c from mitochondria
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
GO:2001268 negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005788 endoplasmic reticulum lumen
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0019898 extrinsic component of membrane
GO:0035579 specific granule membrane
GO:0042995 cell projection
GO:0070161 anchoring junction
GO:0098552 side of membrane
GO:0098637 protein complex involved in cell-matrix adhesion
GO:1905370 serine-type endopeptidase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ywh, PDBe:1ywh, PDBj:1ywh
PDBsum1ywh
PubMed15861141
UniProtQ03405|UPAR_HUMAN Urokinase plasminogen activator surface receptor (Gene Name=PLAUR)

[Back to BioLiP]