Structure of PDB 1ytc Chain A

Receptor sequence

>1ytcA (length=112) Species: 4932 (Saccharomyces cerevisiae)

AKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSG
QVKGYSYTDAIINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDR
NDLITYMTKAAK

3D structure

• PDB: 1ytc Thermodynamic cycles as probes of structure in unfolded proteins.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	R13 C14 C17 H18 G29 L32 I35 S40 Y46 Y48 T49 I52 W59 M64 Y67 L68 T78 K79 M80 F82 M98	R22 C23 C26 H27 G38 L41 I44 S49 Y55 Y57 T58 I61 W68 M73 Y76 L77 T87 K88 M89 F91 M107

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:1ytc, PDBe:1ytc, PDBj:1ytc
• PDBsum: 1ytc
• PubMed: 8639684
• UniProt: P00045|CYC7_YEAST Cytochrome c isoform 2 (Gene Name=CYC7)