Structure of PDB 1yqq Chain A

Receptor sequence
>1yqqA (length=273) Species: 562 (Escherichia coli) [Search protein sequence]
QFSHNPLFCIDIIKTYKPDFTPRVAFILGSGLGALADQIENAVAISYEKL
PGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTF
KLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFG
ERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRM
MQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQT
LAAAELSKQNFINLICGFLRKIA
3D structure
PDB1yqq Escherichia coli Purine Nucleoside Phosphorylase II, the Product of the xapA Gene
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S34 H65 H87 Y89 E90 A117 M215 S216 N239 A241 H251
Catalytic site (residue number reindexed from 1) S30 H61 H83 Y85 E86 A113 M211 S212 N235 A237 H247
Enzyme Commision number 2.4.2.1: purine-nucleoside phosphorylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 A H65 R85 H87 N116 S216 H61 R81 H83 N112 S212
BS02 GUN A A118 G119 E197 G214 M215 T238 N239 T254 A114 G115 E193 G210 M211 T234 N235 T250
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004731 purine-nucleoside phosphorylase activity
GO:0016757 glycosyltransferase activity
GO:0016763 pentosyltransferase activity
GO:0042802 identical protein binding
GO:0047724 inosine nucleosidase activity
GO:0047975 guanosine phosphorylase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006148 inosine catabolic process
GO:0006149 deoxyinosine catabolic process
GO:0006152 purine nucleoside catabolic process
GO:0006161 deoxyguanosine catabolic process
GO:0009116 nucleoside metabolic process
GO:0015949 nucleobase-containing small molecule interconversion
GO:0034214 protein hexamerization
GO:0034355 NAD salvage
GO:0046115 guanosine catabolic process
GO:0055086 nucleobase-containing small molecule metabolic process
GO:1903228 xanthosine catabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yqq, PDBe:1yqq, PDBj:1yqq
PDBsum1yqq
PubMed15808857
UniProtP45563|XAPA_ECOLI Purine nucleoside phosphorylase 2 (Gene Name=xapA)

[Back to BioLiP]