Structure of PDB 1yop Chain A

Receptor sequence
>1yopA (length=83) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MVSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPS
CSLMIDVVFDKEDLAEYYEEAGIHPPEPIAAAA
3D structure
PDB1yop Solution structure of Kti11p from Saccharomyces cerevisiae reveals a novel zinc-binding module.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C26 C28 C48 C51 C26 C28 C48 C51
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0016730 oxidoreductase activity, acting on iron-sulfur proteins as donors
GO:0034986 iron chaperone activity
GO:0046872 metal ion binding
GO:0090560 2-(3-amino-3-carboxypropyl)histidine synthase activity
Biological Process
GO:0002098 tRNA wobble uridine modification
GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation
GO:0008033 tRNA processing
GO:0017183 protein histidyl modification to diphthamide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yop, PDBe:1yop, PDBj:1yop
PDBsum1yop
PubMed15952786
UniProtQ3E840|DPH3_YEAST Diphthamide biosynthesis protein 3 (Gene Name=KTI11)

[Back to BioLiP]